PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT1G27360.3
Common NameF17L21.14, SPL11
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family SBP
Protein Properties Length: 393aa    MW: 43864 Da    PI: 8.1355
Description squamosa promoter-like 11
Gene Model
Gene Model ID Type Source Coding Sequence
AT1G27360.3genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP127.84.1e-40174250177
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                  +Cq++gCe dls+ak yhr+hkvCe+hsk+p+v vsgle+rfCqqCsrfh++sefDe+krsCr+rL++hn+rrrk+q
  AT1G27360.3 174 RCQIDGCELDLSSAKGYHRKHKVCEKHSKCPKVSVSGLERRFCQQCSRFHAVSEFDEKKRSCRKRLSHHNARRRKPQ 250
                  6**************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.5E-32168236IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.129172249IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-37173251IPR004333Transcription factor, SBP-box
PfamPF031102.6E-30175248IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046872Molecular Functionmetal ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000014anatomyrosette leaf
PO:0000037anatomyshoot apex
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0008019anatomyleaf lamina base
PO:0009005anatomyroot
PO:0009006anatomyshoot system
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009025anatomyvascular leaf
PO:0009029anatomystamen
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009047anatomystem
PO:0009049anatomyinflorescence
PO:0009052anatomyflower pedicel
PO:0020038anatomypetiole
PO:0025022anatomycollective leaf structure
PO:0025281anatomypollen
PO:0001054developmental stagevascular leaf senescent stage
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007064developmental stageLP.12 twelve leaves visible stage
PO:0007098developmental stageLP.02 two leaves visible stage
PO:0007103developmental stageLP.10 ten leaves visible stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MDCNMVSSSQ WDWEHLIMSN PSRTEDDSKQ LPTEWEIEKG EGIESIVPHF SGLERVSSGS  60
ATSFWHTAVS KSSQSTSINS SSPEAKRCKL ASESSPGDSC SNIDFVQVKA PTALEVSVAS  120
AESDLCLKLG KRTYSEEYWG RNNNEISAVS MKLLTPSVVA GKSKLCGQSM PVPRCQIDGC  180
ELDLSSAKGY HRKHKVCEKH SKCPKVSVSG LERRFCQQCS RFHAVSEFDE KKRSCRKRLS  240
HHNARRRKPQ GVFSMNPERV YDRRQHTNML WNGVSLNARS EEMYEWGNNT YDTKPRQTEK  300
SFTLSFQRGN GSEDQLVASS SRMFSTSQTS GGFPAGKSKF QLHGEDVGEY SGVLHESQDI  360
HRALSLLSTS SDPLAQPHVQ PFSLLCSYDV VPK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-271752481184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1230247KKRSCRKRLSHHNARRRK
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.4970.0flower| inflorescence| root
Expression -- Microarray ? help Back to Top
Source ID E-value
Genevisible264444_at0.0
Expression AtlasAT1G27360-
AtGenExpressAT1G27360-
ATTED-IIAT1G27360-
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Expressed constitutively during plant development, weak increase during flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}.
Functional Description ? help Back to Top
Source Description
TAIRIn conjunction with SPL10 and SPL2, SPL11 redundantly controls proper development of lateral organs in association with shoot maturation in the reproductive phase.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}.
Function -- GeneRIF ? help Back to Top
  1. SPL10, SPL11 and SPL2 regulate morphological traits of cauline leaves and flowers, and control shoot maturation not only in the vegetative phase but also in the reproductive phase.
    [PMID: 19880401]
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00161DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT1G27360.3
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- MicroRNA ? help Back to Top
Source Description
miRTarBaseRegulated by ath-miR156d
Interaction ? help Back to Top
Source Intact With
IntActSearch Q9FZK0
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT1G27360
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ0116350.0AJ011635.1 Arabidopsis thaliana (ecotype Columbia) mRNA for squamosa promoter binding protein-like 11.
GenBankAY0701060.0AY070106.1 Arabidopsis thaliana putative squamosa-promoter binding protein 2 (At1g27360) mRNA, complete cds.
GenBankAY0881850.0AY088185.1 Arabidopsis thaliana clone 42666 mRNA, complete sequence.
GenBankAY0912860.0AY091286.1 Arabidopsis thaliana putative squamosa-promoter binding protein 2 (At1g27360) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001077603.10.0squamosa promoter-binding-like protein 11
RefseqNP_001077604.10.0squamosa promoter-binding-like protein 11
RefseqNP_564280.10.0squamosa promoter-binding-like protein 11
RefseqNP_973920.10.0squamosa promoter-binding-like protein 11
SwissprotQ9FZK00.0SPL11_ARATH; Squamosa promoter-binding-like protein 11
TrEMBLD7KBP30.0D7KBP3_ARALL; Putative uncharacterized protein
STRINGAT1G27360.10.0(Arabidopsis thaliana)
Publications ? help Back to Top
  1. Cardon G, et al.
    Molecular characterisation of the Arabidopsis SBP-box genes.
    Gene, 1999. 237(1): p. 91-104
    [PMID:10524240]
  2. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  3. Rhoades MW, et al.
    Prediction of plant microRNA targets.
    Cell, 2002. 110(4): p. 513-20
    [PMID:12202040]
  4. Schmid M, et al.
    Dissection of floral induction pathways using global expression analysis.
    Development, 2003. 130(24): p. 6001-12
    [PMID:14573523]
  5. Yamada K, et al.
    Empirical analysis of transcriptional activity in the Arabidopsis genome.
    Science, 2003. 302(5646): p. 842-6
    [PMID:14593172]
  6. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  7. Kim WY, et al.
    ZEITLUPE is a circadian photoreceptor stabilized by GIGANTEA in blue light.
    Nature, 2007. 449(7160): p. 356-60
    [PMID:17704763]
  8. Wang JW,Schwab R,Czech B,Mica E,Weigel D
    Dual effects of miR156-targeted SPL genes and CYP78A5/KLUH on plastochron length and organ size in Arabidopsis thaliana.
    Plant Cell, 2008. 20(5): p. 1231-43
    [PMID:18492871]
  9. Shikata M,Koyama T,Mitsuda N,Ohme-Takagi M
    Arabidopsis SBP-box genes SPL10, SPL11 and SPL2 control morphological change in association with shoot maturation in the reproductive phase.
    Plant Cell Physiol., 2009. 50(12): p. 2133-45
    [PMID:19880401]
  10. Nodine MD,Bartel DP
    MicroRNAs prevent precocious gene expression and enable pattern formation during plant embryogenesis.
    Genes Dev., 2010. 24(23): p. 2678-92
    [PMID:21123653]
  11. Xing S,Salinas M,H
    miR156-targeted and nontargeted SBP-box transcription factors act in concert to secure male fertility in Arabidopsis.
    Plant Cell, 2010. 22(12): p. 3935-50
    [PMID:21177480]
  12. Arabidopsis Interactome Mapping Consortium
    Evidence for network evolution in an Arabidopsis interactome map.
    Science, 2011. 333(6042): p. 601-7
    [PMID:21798944]